Download presentation
Presentation is loading. Please wait.
1
Peptide Mass Finger-Printing Part II. MALDI-TOF
2016 생화학 실험 (1) 6주차 Laboratory of Tumorigenesis & Senescence 과학원 S402호 신소연
2
Concept of Mass Spectrometry
What is the Mass Spectrometer? Instrument measuring molecular weight (MW) of sample Only picomolar concentrations is required Accuracy of 0.01% of total weight of sample Able to detect amino acid substitution/post-translational modifications
3
How does Mass Spectrometer work?
4
Photomultiplier Electron multiplier
Types of Machines & Techniques High Vacuum System 1.Inlet 2.Ion Source 3.Mass Analyzer 4.Detector 5.Data System HPLC Flow injection Sample plate MALDI ESI FAB LSIMS EI CI Time of flight (TOF) Quadrupole Ion Trap Magnetic Sector FTMS Microchannel plate Photomultiplier Electron multiplier
5
Sample Preparation N K R C R K K K Trypsin K R Protein R N K K R C
6
How does Mass Spectrometer work?
7
1. Inlet : MALDI-TOF matrix
8
1. Inlet : MALDI-TOF matrix
9
How does Mass Spectrometer work?
10
2. Ion Source : MALDI (Matrix Assisted Laser Desorption Ionization)
11
2. Ion Source : MALDI (Matrix Assisted Laser Desorption Ionization)
Sample plate Laser hn Ionization is triggered by a laser beam. → A matrix is used to protect the biomolecule from being destroyed by direct laser beam and to facilitate vaporization and ionization. AH+
12
Which ion will strike the detector faster?
Ion Source : MALDI (Matrix Assisted Laser Desorption Ionization) Which ion will strike the detector faster? Laser The ions enter the flight tube with the lighter ions traveling faster than the heavier ions. SO, GREEN ION WILL STRIKE THE DETECTOR FASTER! AH+
13
How does Mass Spectrometer work?
14
Linear TOF is used in larger molecules.
Mass Analyzer : TOF (Time Of Flight) Linear TOF Linear TOF is used in larger molecules. *we are going to use reflectron TOF.
15
Mass Analyzer : TOF (Time Of Flight)
+22 kV 1) Ions enter source region, accelerated toward reflectron. Reflectron TOF 2) Ions separate in space based on their relative mass-to-charge (m/z). 0 kV 0 kV 3) Ions reverse path in reflectron. 4) Ions impact detector. M+ Flight time Signal L+ H+ 0 kV 0 kV H+ [Molecular weight] L+ M+ +20 kV amp comp
16
How does Mass Spectrometer work?
17
Detection 정확도 ( Accuracy ) → How accurate is the mass measurement?
→ MALDI-TOF 에서 측정한 질량값과 실제값의 차이로, ppm 또는 %로 표시 분리능 ( Resolution ) → How well separated are the peaks from each other? → 분자량이 비슷한 화합물들을 분리할 수 있는 정도를 나타냄 민감도 ( Sensitivity ) → How small an amount can be detected / analyzed? → 미량의 시료를 검출할 수 있는 정도를 나타내며 pmol ,fmol 로 표시
18
Mass measurement accuracy depends on Resolution.
Detection Mass measurement accuracy depends on Resolution. High resolution means better mass accuracy. 2000 4000 6000 8000 Counts 2840 2845 2850 2855 Mass (m/z) Resolution = 14200 Resolution = 4500 Resolution =18100
19
Theoretical MALDI TOF SPECTRUM Of ONE PEPTIDE
Detection Theoretical MALDI TOF SPECTRUM Of ONE PEPTIDE MH+ 10000 20000 30000 40000 149876 Relative Abundance (M+2H)2+ (M+3H)3+ 150000 50000 100000 150000 200000
20
Detection 149876 One 13C atom “Monoisotopic mass” Two 13C atoms
No 13C atoms (all 12C) Three 13C atoms 150000 m/z We calculate resolution and accuracy with these peaks. Annotations on spectra will be for the monoisotopic peaks only.
21
Detection H+ [M + 5H]5+ [M + 4H]4+ [M + 3H]3+ [M + 2H]2+ [MH]+ 2500
M/Z = 10,003 / 3 M/Z = 3334 M/Z = 10,005 / 5 M/Z = 2001 M/Z = 10,004 / 4 M/Z = 2501 M/Z = 10,002 / 2 M/Z = 5001 M/Z = 10,001 / 1 M/Z = 10,001 Relative Intensity(%) 2500 5000 10000 (M+2H)2+ MH+ The same protein with a molecular weight of 10,000 contains 5, 4, 3, 2, and 1 charges. (M+3H)3+ (M+4H)4+ (M+5H)5+ 2001 2501 3334 5001 10001
22
How does Mass Spectrometer work?
23
Tryptic peptide mixture. Every peptide has a basic C-terminus.
Database N K K R K K K R K K Trypsin K K K R R R Protein R R N C K K R Tryptic peptide mixture. Masses measured by MS. Every peptide has a basic C-terminus. C A protein can be identified in a database by matching masses of a subset of the tryptic peptides against calculated values.
24
Database intact protein peptide fragments enzyme
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVS PFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVW EQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIK SYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRE SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL LEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDED HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
25
Database Gel In Silico Digestion is identical to Database
In Gel Digestion 848.3 1272.7 493.2 882.6 2978.3 364.1 948.9 3128.8 3514.2 2837.1 263.9 147.4 1429.7 199.6 142.3 640.8 848.1 1272.5 492.6 883.2 2978.9 812.6 1432.3 3127.1 996.8 702.4 164.9 2748.2 is identical to
26
Database
27
실험 방법 Desalting Methods [준비물]
Poros buffer(C18 resin in 70% ACN), Zip tip, 100% ACN, 2% Formic Acid, MATRIX buffer(CHCA 8~10mg in 70% ACN) [순서] 1. zip tip의 끝 0.3~0.5cm 정도를 구부린다. 2. Poros buffer를 1~2ul넣어 실린지로 밀어준다. ( Zip tip 끝에 3~5mm정도 충진되도록) 3. 100% ACN(10ul)로 C18 resin을 wash 해준다. 4. 2% Formic Acid(20ul)로 C18 resin을 activation 시킨다. 5. Sample(peptide)을 흘려준다. 6. 2% Formic Acid(10ul)로 peptide외의 chemical을 wash 해준다. 7. Plate 위에 Matrix buffer를 loading(1ul)함으로써 Matrix와 peptide를 회수한다.
28
실험 방법 MALDI-TOF analysis [순서] 1. Plate를 MALDI 기기 안으로 injection한다.
2. 기기의 laser를 켜고 약 10-30분간 laser를 안정화시킨다. 3. plating한 Standard sample을 큰 오차범위에서 작은 오차범위로 서서히 좁혀가며 찍어본다. (Standard solution: Examples include Angiotensin II, ACTH fragment) - Calibration : 기기의 오차범위를 줄여줌. Resolution / peak intensity 를 확인하며, laser의 강도/mirror의 위치를 조정하여 분석에 최적화시킨다. 4. Standard sample을 분석한 후, 분석하고자 하는 시료를 분석한다. 5. 분석 후 결과 spectrum을 추출 프로그램(Data explorer)을 사용하여, spectrum list를 작성한다. 6. Data search engine (profound ; Mascot; MS-fit)에 입력한다. (이 때 시료에 사용한 효소, 시약으로 인한 modify를 지정하고, 시료의 종(taxonomy) 등을 설정하여 준다.) 7. 분석된 결과를 토대로 유의성 여부를 검토한다.
29
1. www.matrixscience.com 접속 >> FREE search
실험결과 처리 방법 1. 접속 >> FREE search
30
2. Peptide Mass Fingerprint > Perform search
실험결과 처리 방법 2. Peptide Mass Fingerprint > Perform search
31
실험결과 처리 방법 3. Search parameter 지정 1 2 3 4 5 7 8 9 10 11 6 Fin
32
실험결과 처리 방법 4. Result 출력 : 예시 1
33
실험결과 처리 방법 4. Result 출력 : 예시 2
34
보고서 작성 방법 Format : 실험제목, 실험일자, 제출자 및 공동실험자, 목적, 원리, 시약 및 기자재, 실 험 방법, 실험 결과, 고찰, 참고문헌 실험일자에 요일 꼭 써주세요! 방법은 실험교본 그대로 말고, 직접 실험한 방법! 고찰 section에 꼭 필요한 내용 1-1. Mascot Search result 에서 결과값이 cut off를 넘긴 경우 : cut off를 넘긴 protein의 분자량과 match된 peptide 수에 대해 쓰고, 1순위 protein에 대해 간단하게 조사 1-2. Mascot Search result 에서 결과값이 cut off를 넘지 못 한 경우 : 왜 cut off를 넘기 지 못했는지에 대한 고찰과 1순위 protein에 대한 간단하게 조사 2. DTT 사용하는 이유와 원리 및 DTT를 대체하여 사용 할 수 있는 시약 3. IAA 사용하는 이유와 원리 및 IAA를 대체하여 사용 할 수 있는 시약 (IAA처리할 때 왜 어둡게 하는지도 조사 할 것) 4. Matrix의 역할 및 기능에 대해서 자세하게 조사 5. Mascot Search 시, Fixed Modification에 carbamidomethyl을 설정해주었는데, 그 이 유와 carbamidomethylation이 생성되는 원리 조사 DUE DATE : 중간고사 시험 당일 (4/23) – 반드시 시험 시작 전에 제출 할 것!! (시험 시작 후부터는 감점)
35
[생화학실험(1) 중간고사 일정] 장소 : 과B133 일시 : 2016년 4월 23일 토요일 5-6교시
Similar presentations