Presentation is loading. Please wait.

Presentation is loading. Please wait.

프로테옴 데이터 분석을 위한 바이오인포매틱스 기술

Similar presentations


Presentation on theme: "프로테옴 데이터 분석을 위한 바이오인포매틱스 기술"— Presentation transcript:

1 프로테옴 데이터 분석을 위한 바이오인포매틱스 기술
한국기초과학지원연구원 프로테옴분석팀 권 경 훈

2 목 차 프로테오믹스 단백질의 질량스펙트럼 탄뎀 질량스펙트럼 프로테옴 데이터베이스 시스템 ICAT 방법에 의한 프로테옴 정량분석

3 프로테옴 (Proteome), 프로테오믹스 (Proteomics)
Protein + ome = Proteome 특정 세포나 특수 상황에서 만들어지고 작용하는 단백질들의 총합 프로테오믹스(Proteomics) 환경이 바뀜에 따라서 단백질들이 어떻게 생성되고 변화하며 어떻게 상호작용하는가를 연구

4 Information Technology
Omics 와 informatics Biotechnology Genomics Proteomics Metabolomics Genome informatics Proteome informatics Metabolism informatics Bioinformatics Information Technology

5 Characterization of proteome
Omics 의 관계 Molecular machinery of cellular processes metabolomics Characterization of proteome 1989 Peptide mass fingerprinting 1986 peptide sequencing by MS/MS proteomics Genome sequencing genomics

6 Proteome informatics 단백질 동정 기술 통합 Database 구축 단백질 기능, 구조 분석
System biology

7 프로테오믹스 단백질의 질량스펙트럼 탄뎀 질량스펙트럼 프로테옴 데이터베이스 시스템 ICAT 방법에 의한 프로테옴 정량분석

8 프로테옴 데이터 electrophoresis Mass spectrometry Database search 단백질 분리
펩타이드 분자량 측정 단백질 동정

9 단백질의 질량 스펙트럼 Protein database Peptide sequences Protein id 질량분석기
효소 질량분석기 MS spectrum 단백질 Protein database Peptide sequences Protein id A B A B

10 Mass spectrum (peptide mass fingerprint)
intensity

11 Mass spectrum vs. database
Protein A Protein B Protein C

12 Peptide mass match ….FNSTPKYIKSEGYGPREKYQSRPKFNSTPKDYN… Mass spectrum
intensity Spectrum of a protein in DB FNSTPK YIK YQSRPKFNSTPK FNSTPKYIK Tolerance ?

13 단백질 데이터베이스 non-redundant protein DB
효소: trypsin Protein mass (0-150kDa) Peptide mass (0-12.5kDa)

14 PMF search programs MS-Fit MASCOT PeptIdent PeptideSearch
MASCOT PeptIdent PeptideSearch

15 MS-Fit

16 아미노산 분자량 아미노산 기호 MW (Da) Alanine A 71.03711 Methionine M 131.04049
Cysteine C Asparagine N Aspartic acid D Proline P Glutamic acid E Glutamine Q Phenylalanine F Arginine R Glycine G Serine S Histidine H Threonine T Isoleucine I Valine V Lysine K Tryptophan W Leucine L tyrosine Y

17 Peptide mass fingerprint 의 한계
Mass tolerance 내에서 분자량이 일치하는 아미노산 서열을 찾아야 함. modification 문제 대부분의 경우 여러 단백질을 검색 결과로 얻으므로 검색결과의 신뢰도가 문제 발생. 확인 과정 필요 많은 양의 프로테옴 데이터 검색을 위해서는 batch 작업이 필요함.

18 PMF search results 통계

19 프로테오믹스 단백질의 질량스펙트럼 탄뎀 질량스펙트럼 프로테옴 데이터베이스 시스템 ICAT 방법에 의한 프로테옴 정량분석

20 탄뎀 질량 스펙트럼 (MS/MS spectrum)
energy 효소 1st MS 2nd MS 단백질 MS spectrum Peptide sequence Protein id Protein database Tandem MS spectrum

21 탄뎀 질량 스펙트럼 Peptide fragmentation
x3 y3 z x2 y2 z x1 y1 z1 H2N COOH R1 C H O N R2 R3 R4 a1 b1 c a2 b2 c a3 b3 c3

22 단백질 동정 (protein identification)
intensity Peptide 의 탄뎀 질량 스펙트럼 compare m/z intensity a spectrum of a peptide in database m/z

23 modification K K E T E T oxidation M M P P I I M M A A

24 MS/MS Search programs MASCOT http://www.matrixscience.com/ MS-TAG
SEQUEST

25 MASCOT

26 MASCOT output

27 Sequencing intensity …EDCBA …DECBA A B C DE
m/z b1 y1 y2 y y5 b7y b12 y y10 y12b17 y18a22

28 BLAST

29 Scores Homology search (BLAST) alignment score e-value
Peptide Mass Fingerprint Number of matched peptides Coverage MOWSE score Probability based on MOWSE score Tandem mass search Cross-correlation coverage

30 프로테오믹스 단백질의 질량스펙트럼 탄뎀 질량스펙트럼 프로테옴 데이터베이스 시스템 ICAT 방법에 의한 프로테옴 정량분석

31 Proteomics Trends High-throughput Proteomics 2. Quantitation
High-throughput automated identification of proteins 2. Quantitation Quantitation of relative protein abundance

32 Proteome Database System for High-Throughput proteomics
Proteome DB server Data management system instrument Mass spectrometer Mass spectrometer Mass spectrometer Mass spectrometer Mass spectrometer Mass spectrometer Mass search program database swissprot nr EST user Web server user user

33 프로테오믹스 단백질의 질량스펙트럼 탄뎀 질량스펙트럼 프로테옴 데이터베이스 시스템 ICAT 방법에 의한 프로테옴 정량분석

34 Quantitation: ICAT (Isotope-coded Affinity Tag)
정량적 단백질 발현 분석의 혁신적인 방법 서로 다른 환경에서 발현된 단백질들을 비교하는 정량적 분석 방법 2D gel 의 단점 보완 실험의 반복성 구현 실험 소요시간 단축 (1 week/exp.) membrane protein 분석 가능 작은 분자량의 단백질 측정

35 ICAT 방법에 의한 프로테옴 정량분석 Sample 1 Mass spectrometry Sample 2
Labeled at Cysteines Sample 1 Sample 2 d8 d0 Pool of labeled proteins Mass spectrometry Digest and purify

36 단백질 동정 (ICAT) Mass spectrum Tandem Mass spectrum

37 KBSI 프로테옴 DB 서버 구축 (KISTI 위탁과제)
Java MySQL DB MALDI/TOF-TOF perl PHP File system ESI/Q-TOF Web server 데이터 입력 시료정보 스펙트럼 데이터 단백질 검색정보 user

38 한국기초과학지원연구원 프로테옴분석팀 김승일 박사 : 팀장 : 2D-gel Post doc. :
박영목 박사 : 프론티어 과제 수행 유종신 박사 : 선임부장 : 질량분석 김수현 박사 : 탄수화물 분석 정영호 박사 : 형광분석기기 김영환 박사 : MALDI/TOF-TOF 최종순 박사 : DNA sequencing system 김진영 박사 : LC/MS, ESI/Q-TOF 조 건 : Tandem Mass 권경훈, 김미옥 박사 : informatics Post doc. : 안영희, 김영혜, 권수미 위촉연구원 : 김재우, 이정화, 전영선, 황수경, 권금녀, 김경욱,김수정, 김은아, 문윤정, 박영재, 박은정, 송승열, 유용철, 이경민, 이영재, 이용주, 이은미, 조미선, 조옥기, 정미영,

39 감사합니다. Proteome Informatics 교육 안내 실험실용 Protein Informatics 시스템 개발 교육
12월 3일(화) 오후 1:00 – 5: 30 장소: 한국기초과학지원연구원 (대전본원) ( )


Download ppt "프로테옴 데이터 분석을 위한 바이오인포매틱스 기술"

Similar presentations


Ads by Google